PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KN538726.1_FGP094
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GRAS
Protein Properties Length: 442aa    MW: 47236.6 Da    PI: 6.2154
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KN538726.1_FGP094genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS1302.7e-401323682233
               GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkf 93 
                        ve+L+++A+  ++gd  +a+++La    l ++++ p+ R a yf+ AL++ l++ v+   ++ p+ + + ++   +l+a+k+fs++sP+l f
  KN538726.1_FGP094 132 VEQLVQAAKLTEAGDVLAARHILAINYRLPASAAPPLLRSALYFKDALRRALNSDVDDDDSSTPTLTPPIHDLLLKLTAYKAFSDLSPLLHF 223
                        689**********************999**************************999999999999999999******************** PP

               GRAS  94 shltaNqaIleavege...ervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg....skeeleetgerLakfAeelgvpfef 178
                        +h+t+ qa+l++++ +   +++H +Dfdi+ G QW++L++ La R  g   l++T+++  +s+    +  +l+ +++ L+ fA+ l vpf+f
  KN538726.1_FGP094 224 AHFTCVQAVLDELAPSascSCIHLLDFDIGVGEQWASLMHDLAHRHPG-VALKVTALNVTASSssshHPLQLQLIHDTLSTFAADLSVPFRF 314
                        ************987766799************************644.7899999887666566668899********************* PP

               GRAS 179 nvlvakrledleleeL.rvkp.gEalaVnlvlqlhrlldesvsleserdevLklvks 233
                         ++   +l++ +l  L +v    +a+aV+l +   +  + +  l+ + +++L+l+ s
  KN538726.1_FGP094 315 AAF---NLDATDLTPLlAVAAaTDAIAVHLPVGSVHATAVPSVLHLALRSTLSLLES 368
                        **7...5555555554255557*********99999888887777777888877766 PP

2GRAS38.61.6e-12358440260344
               GRAS 260 aleyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkv 344
                        al+   +l++sl+a  +++s+ ++k+Er++++++i+++v ++      +++ ++ W + l +aGF pv++s+ a++qa++ll+k 
  KN538726.1_FGP094 358 ALRSTLSLLESLDAM-GTDSNVAAKIERFWVQPKIQECVRAAVGV-GGDKTAASAWGATLASAGFVPVQVSSMAEAQAESLLKKL 440
                        7889999*****998.99*********************988776.6888899*****************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098525.384105442IPR005202Transcription factor GRAS
PfamPF035149.3E-38132368IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 442 aa     Download sequence    Send to blast
MRRDPIVALV HFELDQVTGK RPSIGELAAN IASSSFTLTS PGLRPPTHAA STPPPPPWLV  60
DADHHHDNTF LHWVINDHHH PLLDLDDVDL DYAKPAPNSF FADRGLHHHH PGPASSSFPN  120
PKPTADDNTS TVEQLVQAAK LTEAGDVLAA RHILAINYRL PASAAPPLLR SALYFKDALR  180
RALNSDVDDD DSSTPTLTPP IHDLLLKLTA YKAFSDLSPL LHFAHFTCVQ AVLDELAPSA  240
SCSCIHLLDF DIGVGEQWAS LMHDLAHRHP GVALKVTALN VTASSSSSHH PLQLQLIHDT  300
LSTFAADLSV PFRFAAFNLD ATDLTPLLAV AAATDAIAVH LPVGSVHATA VPSVLHLALR  360
STLSLLESLD AMGTDSNVAA KIERFWVQPK IQECVRAAVG VGGDKTAASA WGATLASAGF  420
VPVQVSSMAE AQAESLLKKL PF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-1616443736340GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2139080.0AC213908.1 Oryza glaberrima clone OG_BBa0062I05, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015629082.10.0PREDICTED: scarecrow-like protein 6, partial
TrEMBLA0A0D9Z0U80.0A0A0D9Z0U8_9ORYZ; Uncharacterized protein
TrEMBLB9FAA50.0B9FAA5_ORYSJ; Uncharacterized protein
STRINGBGIOSGA011665-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP67232954
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00150.11e-21GRAS family protein